Vreelandella sp. SM1641: V8F66_08620 Help Entry V8F66_08620       CDS       T11229                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vrs  Vreelandella sp. SM1641 Pathway vrs01100   Metabolic pathways vrs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vrs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V8F66_08620 (acpP)    00074 Mycolic acid biosynthesis     V8F66_08620 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V8F66_08620 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  XBY60524 UniProt:  A0AAU7XV37 LinkDB All DBs Position 1864177..1864410 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgttaagaaagtggtagcagagcgcctgaacgttaaagaa gaagacatccaaaacagctcttcttttacagaagacttgggtgctgattcgctcgacacc gttgagctggtcatggctttggaagaggaattcgatactgaaattcctgatgaagaagct gagaaaatcaccacggttcaagaagccatcgattacgtgaacgcccaccagtaa

DBGET integrated database retrieval system