Vibrio ruber: RND59_17155 Help Entry RND59_17155       CDS       T09542                                  Symbol ppiC Name (GenBank) peptidylprolyl isomerase PpiC   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism vru  Vibrio ruber Brite KEGG Orthology (KO) [BR:vru00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:vru03110]     RND59_17155 (ppiC) Enzymes [BR:vru01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      RND59_17155 (ppiC) Chaperones and folding catalysts [BR:vru03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     RND59_17155 (ppiC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 Ribo_biogen_C DUF4685 Motif Other DBs NCBI-ProteinID:  WNJ97854 LinkDB All DBs Position 2:complement(301284..301562) Genome browser AA seq 92 aa AA seqDB search MARTAAALHILVKHQNQAEDILQQLKKGAKFQTLARKYSLCPSGKKGGDLGEFRQGQMVP AFDKACFRGEVLKPQIVKTKFGWHVIKVLYRT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcaagaacagcagcagctttgcatattctggtaaaacatcagaatcaggcggaagat atcctacagcagcttaaaaagggcgcgaaatttcaaacacttgcccgaaaatattcttta tgtccttccggcaagaaaggcggtgatttgggggagtttcgtcaggggcaaatggtacct gcatttgacaaagcctgttttcggggggaagtgctcaaaccacagattgtcaaaaccaaa tttggctggcatgtgattaaagtgctgtaccggacgtga

DBGET integrated database retrieval system