Vibrio scophthalmi: VSVS12_00365 Help Entry VSVS12_00365      CDS       T04650                                  Name (GenBank) Cell division protein ZapB   KO K09892   cell division protein ZapB Organism vsc  Vibrio scophthalmi Brite KEGG Orthology (KO) [BR:vsc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vsc03036]     VSVS12_00365 Chromosome and associated proteins [BR:vsc03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     VSVS12_00365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA Nuf2_DHR10-like APG6_N PspA_IM30 ERM_helical DUF7491 Syntaxin Dor1 CENP-F_leu_zip GAS CCDC106 Dynamin-like_hel_bact TMF_TATA_bd NET2A Herpes_UL6 Ax_dynein_light HAUS-augmin3 DUF2203 DUF3450 CsiV OVT1 WXG100 bZIP_1 Tup_N Spc7 NUDE_C K-box YwqH-like DUF724 ATP-synt_D HALZ Muted THOC7 Mod_r COG3_N DivIC NPV_P10 ADIP DUF4337 FapA UPF0242 GrpE DUF4140 SPAM DUF1664 Mis12 Sipho_Gp157 AAA_13 DUF2205 5_nucleotid Prefoldin_2 Prefoldin OmpH Prominin MCU XRCC4_CC UPF0449 ATG14 Sas-6_C_CC PCRF EMC3_TMCO1 Motif Other DBs NCBI-ProteinID:  ANS84182 UniProt:  A0A1B1NKE1 LinkDB All DBs Position 1:386726..386968 Genome browser AA seq 80 aa AA seqDB search MSFEVLEQLEAKIQTAVDTISLLQMEVEELKEEKEQLASEASELRANREELEQKAAAMQQ EHSAWQDRIRNLLGKMDDVE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcttttgaagtactagaacaactagaagcaaaaattcaaactgcagtagatacaatt tcacttcttcaaatggaagtagaagagcttaaagaagaaaaagagcaattggcttcagaa gcaagtgaactacgcgctaaccgtgaagagctagagcaaaaagcagccgcaatgcaacaa gagcattcagcatggcaagatcgtatccgtaacctactaggtaaaatggacgacgtagag taa

DBGET integrated database retrieval system