Vibrio scophthalmi: VSVS12_01242 Help Entry VSVS12_01242      CDS       T04650                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism vsc  Vibrio scophthalmi Pathway vsc01100   Metabolic pathways vsc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vsc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VSVS12_01242    00074 Mycolic acid biosynthesis     VSVS12_01242   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VSVS12_01242 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  ANS85009 UniProt:  A0A1B1NMP8 LinkDB All DBs Position 1:1304055..1304288 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDDEA EKITTVQAAIDYVNSAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcattgttgaacagctaggtgtggacgaa gcagaagttaaaaacgaagcttcatttgttgacgatctaggtgctgattctctagacact gttgaactagtaatggctctagaagaagaattcgacactgagattccagacgacgaagct gagaagatcactactgttcaagctgcaatcgactacgtgaacagcgctcagtaa

DBGET integrated database retrieval system