Vibrio mediterranei: BSZ05_16435 Help Entry BSZ05_16435       CDS       T04936                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vsh  Vibrio mediterranei Pathway vsh01100   Metabolic pathways vsh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vsh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSZ05_16435    00074 Mycolic acid biosynthesis     BSZ05_16435   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSZ05_16435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASI91267 UniProt:  A0AAN1FJ71 LinkDB All DBs Position 1:3532837..3533097 Genome browser AA seq 86 aa AA seqDB search MEALQNQIKQLIIDSLNLEDITIDDIETDAPLFGDGLGLDSIDALELGLAIKKTFNIVID ADDTNTREHFASVANLAKYISSQTSN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggaagcactacaaaaccaaatcaaacaactgattattgactccctaaaccttgaagat attactattgacgatatcgaaactgatgcaccactgttcggtgatggtctaggcctagat tccattgatgctcttgaactcggcttagccattaagaaaacgttcaatatcgtaattgac gcagacgataccaatacacgtgaacactttgcatctgtagcaaaccttgcaaagtacatt tcgtctcaaactagcaactaa

DBGET integrated database retrieval system