Vibrio mediterranei: BSZ05_16440 Help Entry BSZ05_16440       CDS       T04936                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vsh  Vibrio mediterranei Pathway vsh01100   Metabolic pathways vsh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vsh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSZ05_16440    00074 Mycolic acid biosynthesis     BSZ05_16440   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSZ05_16440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 CagD Motif Other DBs NCBI-ProteinID:  ASI91268 UniProt:  A0A2C9PEZ9 LinkDB All DBs Position 1:3533113..3533370 Genome browser AA seq 85 aa AA seqDB search MTELNQQQVFDQVKDALVELFEIDEADIQPEAHLYQDLDLDSIDAVDLVVHLQKVTGKKI KPEEFKAVRTVNDVVVSVTELLKDK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacagaattaaaccaacagcaagtatttgaccaagtaaaagacgctctcgtggagctg tttgaaattgacgaagcggatattcaacctgaagctcacctttatcaagaccttgattta gatagcattgatgctgttgatctagtagttcacttgcaaaaagtaactggcaaaaaaatc aagcctgaagagttcaaagctgtacgcaccgttaatgacgttgtggtctctgtgactgag ctattgaaagataaataa

DBGET integrated database retrieval system