Vibrio sinaloensis: MTO69_11555 Help Entry MTO69_11555       CDS       T08230                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism vsi  Vibrio sinaloensis Brite KEGG Orthology (KO) [BR:vsi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vsi03036]     MTO69_11555 (ftsB) Chromosome and associated proteins [BR:vsi03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MTO69_11555 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Motif Other DBs NCBI-ProteinID:  UPQ89301 LinkDB All DBs Position 1:complement(2567076..2567354) Genome browser AA seq 92 aa AA seqDB search MRIFALMLTLILGWLQYELWLGKNGIADFQAVSAEIEVQHQVNSNLKARNDEMFAEIDDL RQGLDAIEERARHELGMIKEGETFYRIIGEDN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgtatatttgctttgatgttgacccttattttaggctggctgcagtatgaactgtgg ctgggcaaaaacgggatcgccgactttcaggcggtcagtgctgagatagaggttcagcat caagtgaacagtaacttgaaagcccgtaacgacgaaatgtttgccgagatcgacgactta cgccaagggctcgatgcgattgaagagcgagcacggcacgaactcggtatgatcaaagaa ggcgagacgttttatcgtattatcggcgaggataattaa

DBGET integrated database retrieval system