Vibrio atlanticus: VS_0784 Help Entry VS_0784           CDS       T00812                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism vsp  Vibrio atlanticus Pathway vsp01100   Metabolic pathways vsp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vsp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VS_0784    00074 Mycolic acid biosynthesis     VS_0784   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VS_0784 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  CAV17767 UniProt:  B7VKK3 LinkDB All DBs Position 1:complement(807823..808080) Genome browser AA seq 85 aa AA seqDB search MTQANQQEVFNQVKDALIELFELDAEDITPEAHLYLDLDLDSIDAVDLVVHLQNVTGKKI KPEEFKAVRTVNDVVESVVELLKDA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacacaagctaaccaacaagaagtattcaaccaggttaaagatgcgcttatcgagctg tttgagcttgatgctgaagatatcactccagaagcacacctttatctcgacctcgatctc gacagcattgatgccgttgatttggtcgttcacttacagaacgttacaggtaagaagatc aagcctgaagagttcaaagcagtacgcaccgttaatgacgttgtcgagtctgtggttgaa ctattgaaggacgcataa

DBGET integrated database retrieval system