Vibrio atlanticus: VS_0785 Help Entry VS_0785           CDS       T00812                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism vsp  Vibrio atlanticus Pathway vsp01100   Metabolic pathways vsp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vsp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VS_0785    00074 Mycolic acid biosynthesis     VS_0785   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VS_0785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAV17768 UniProt:  B7VKK4 LinkDB All DBs Position 1:complement(808091..808351) Genome browser AA seq 86 aa AA seqDB search METLHNELKQLIIDALNLEDMSIDEIETEAPLFGDGLGLDSIDALELGLAIKKKYNIVID ADDSNTRQHFASVENLANYISSKTNN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggaaacattacacaacgaactaaaacaactgattatcgacgcactgaatcttgaagat atgagcattgatgaaattgaaacggaagcaccactgtttggtgatggacttggattagat tctatcgatgcccttgagctcggccttgctatcaagaaaaagtacaacattgttatcgat gccgacgattcaaacactcgccagcattttgcatcggttgaaaacctagctaactacatt tcatctaaaacaaacaactag

DBGET integrated database retrieval system