Vibrio spartinae: Vspart_01357 Help Entry Vspart_01357      CDS       T07037                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism vsr  Vibrio spartinae Pathway vsr00261   Monobactam biosynthesis vsr01100   Metabolic pathways vsr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vsr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Vspart_01357  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vsr01008]     Vspart_01357 Polyketide biosynthesis proteins [BR:vsr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Vspart_01357 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QMV14109 LinkDB All DBs Position 1:1485032..1485223 Genome browser AA seq 63 aa AA seqDB search MIDDVKYTVVLNDEAQYSIWFEERELPAGWQRADYQGSKQECLAYIQQVWTDMRPLSLRK SMD NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgatagatgatgtgaaatacactgtagtgctgaatgatgaagcacaatattcgatttgg tttgaagagcgagagttgcctgctggatggcagcgcgccgattatcaggggagcaagcaa gaatgtctggcatatattcagcaggtctggacggacatgagaccattgagtctgagaaaa tcgatggattaa

DBGET integrated database retrieval system