KEGG   Vibrio spartinae: Vspart_01691
Entry
Vspart_01691      CDS       T07037                                 
Symbol
pigM
Name
(GenBank) putative NAD(P)H nitroreductase PigM
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
vsr  Vibrio spartinae
Pathway
vsr00333  Prodigiosin biosynthesis
vsr01100  Metabolic pathways
vsr01110  Biosynthesis of secondary metabolites
Module
vsr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:vsr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Vspart_01691 (pigM)
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: QMV14436
UniProt: A0A7D8B996
LinkDB
Position
1:1885640..1886689
AA seq 349 aa
MLTTSFEQNLAGAIEIARSAPSSHNCQPWAVHYSPLSRTGYLAIDRHRALKGLPSLENEM
LMSCGIFFQHIETLMRNAGTPLQWTWFDESHTTPTLPQKQDGLICFSPGEKQAANPDAYH
DLAKQIHHRHTNRMPYETTKLSALQQFRLQEMFADSPVQLNIWQDQTSCKQVADLVYQYA
ALDFADKAAWQETYSFIRFDKNKPVEDGFYLHHLFGKIPAYVEWLFRVAFHPKLNLFTRF
LRLPQFMAHEFSKLTGQGPQYLALSLPDPNPHNLFITGMKLARVWLLLEQWGWGIHPLSV
LVQHDLPKATLANTLGMTHLPIFFARFGQVKIAADVSPRRHLDSILTID
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgttgacgacatcgtttgaacaaaacttggccggtgcgattgaaattgctcgttcagcc
ccctcttctcataattgccaaccttgggccgttcactattcacccttatctcgcactggc
tatctggccattgatcggcatcgggctttgaaaggtctgccgtcattagaaaacgaaatg
ttgatgagctgtgggattttctttcagcatattgagacattaatgcgcaatgccggcacc
ccgctgcaatggacatggtttgatgagtctcataccacaccgacactgcctcaaaagcaa
gatggtctcatctgcttctctccgggagagaagcaagctgcaaatccagatgcgtatcat
gatctggcaaagcagatccaccatcgtcataccaaccgcatgccctacgaaacgacaaag
ctctccgcattacaacaatttcggcttcaggaaatgttcgcggattccccagtccaatta
aacatatggcaagatcaaacaagttgtaaacaggttgctgatttagtgtatcaatatgca
gcactggattttgccgacaaagcggcttggcaggaaacctatagttttattcgttttgat
aaaaataaaccagttgaggatgggttctaccttcatcatctatttggcaagatccctgct
tatgtagagtggttattccgggttgcttttcatccgaaactaaacctattcacgcgcttc
ttgcggttaccccagtttatggctcacgagttctcgaaactgaccggacaaggaccgcaa
tatctggctttgagccttcccgatcccaatccgcacaatctgtttatcacgggtatgaag
ctggctcgagtgtggctgttacttgagcaatggggttgggggattcacccgctcagtgtg
ctcgttcaacacgatttacccaaagcaacgctggcaaatacgttgggaatgacccatctg
ccaatattttttgcccggtttgggcaggtcaaaattgcagccgatgtttcgccacgacgt
catttagacagtattttaacgatcgattaa

DBGET integrated database retrieval system