Vibrio tarriae: CEQ48_08870 Help Entry CEQ48_08870       CDS       T08683                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vti  Vibrio tarriae Pathway vti01100   Metabolic pathways vti01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vti00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CEQ48_08870    00074 Mycolic acid biosynthesis     CEQ48_08870   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CEQ48_08870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  ASK54898 UniProt:  A0AAU8WDN5 LinkDB All DBs Position 1:702209..702445 Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIVEQLGVDEAEVKNESSFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTSNAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcattgttgaacagctaggtgtagacgaa gcagaagtaaagaatgaatcttctttcgttgaagacctgggtgctgattctctggatact gttgagctggtaatggctctggaagaggaattcgatactgagattcctgatgaagaagca gagaagatcactactgttcaagctgcgatcgattatgtaaccagcaacgctcagtaa

DBGET integrated database retrieval system