KEGG   Vibrio tarriae: CEQ48_14195
Entry
CEQ48_14195       CDS       T08683                                 
Name
(GenBank) VanZ family protein
  KO
K20950  polysaccharide biosynthesis protein VpsQ
Organism
vti  Vibrio tarriae
Pathway
vti05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vti00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    CEQ48_14195
SSDB
Motif
Pfam: VanZ DUF2279 Virul_fac_BrkB
Other DBs
NCBI-ProteinID: ASK55876
UniProt: A0AAU8WHZ5
LinkDB
Position
1:complement(1860026..1860460)
AA seq 144 aa
MQQRLKIGRQIYQQRPVSLVLFGLLALSTALASWLKSSGWHADYVYQLERAVGGDTHLHG
LLAMLLTLALYRVLSATSHSYKMIIVTGLLVAICCLIDEGIQAFTPLRTFSIQDILASFI
GVTLASVINTMLAGLLQRKQREPY
NT seq 435 nt   +upstreamnt  +downstreamnt
ttgcaacagcgtcttaaaataggccgtcaaatctatcaacagcgtccagtttctttggtg
ttgtttggcttgttagccttgtcgacggctttggcttcttggttgaaatcttccggctgg
catgccgattatgtttaccaattagaaagggcagtggggggagatacccatttgcatggc
ctattagccatgttgctgacgttggcgctgtatcgagtgctttctgccacgagccacagc
tataagatgatcatcgtcactggcctgttggtggcgatttgctgcttgattgatgaaggt
attcaagccttcacaccacttcgcactttttctattcaagacatcttagccagtttcatt
ggggtgacactggccagcgtgatcaacactatgctcgcgggtttactccaacgtaagcaa
agagagccttattag

DBGET integrated database retrieval system