Candidatus Vallotiella hemipterorum: MYVALT_H_00010 Help Entry MYVALT_H_00010    CDS       T07343                                  Name (GenBank) H-NS-like proteins   KO K03746   DNA-binding protein H-NS Organism vtr  Candidatus Vallotiella hemipterorum Brite KEGG Orthology (KO) [BR:vtr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vtr03036]     MYVALT_H_00010    03400 DNA repair and recombination proteins [BR:vtr03400]     MYVALT_H_00010 Chromosome and associated proteins [BR:vtr03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     MYVALT_H_00010 DNA repair and recombination proteins [BR:vtr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       MYVALT_H_00010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF7344 Histone_HNS_N C2c1_Nuc-II DUF6471 Motif Other DBs NCBI-ProteinID:  CAG7605164 UniProt:  A0A8E4GIF1 LinkDB All DBs Position pMVTALT:10766..11005 Genome browser AA seq 79 aa AA seqDB search MDEQKRQKIIAYIHKQMAEYDISVERLAEALAEKEKDIKPVLFRDAYGNVWDGKGEMPNW LKRAVYAGQSTEHFKVKTK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacgaacagaaaagacaaaaaattattgcgtatattcataagcagatggcagaatac gatatctctgttgagcgtttagctgaagcactagctgaaaaagagaaagatataaaacca gtcttgtttcgtgatgcgtatggaaacgtatgggatggcaaaggagaaatgcctaattgg cttaaacgagcagtatatgcagggcagtcaactgagcactttaaggtaaaaacaaaataa

DBGET integrated database retrieval system