Vigna umbellata (ricebean): 124825191 Help Entry 124825191         CDS       T09662                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism vum  Vigna umbellata (ricebean) Pathway vum04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:vum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124825191  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vum04121]     124825191    03400 DNA repair and recombination proteins [BR:vum03400]     124825191 Ubiquitin system [BR:vum04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      124825191    Cul5 complex      124825191 DNA repair and recombination proteins [BR:vum03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124825191 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  124825191 NCBI-ProteinID:  XP_047153699 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKKEDTVKLISAEGFEFVVDKEAAMVSQTIHNMLTSPGSFSERQHGEVTFPEISTTILEK ICQYFYWHLQFASGKETEFPIEPELTLELMMAANYLHT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggaagacacggtaaaactgatcagcgcggagggttttgaatttgtggtcgac aaagaagctgcaatggtttcacagaccatacataacatgcttacttctccagggagtttc tctgagaggcagcacggcgaagttacctttcccgagattagtaccaccattctggagaag atttgccagtacttttattggcatctacaatttgccagtgggaaggaaacggaatttccc attgaacctgagttaactctagagctaatgatggctgccaattacctccatacataa

DBGET integrated database retrieval system