Vigna umbellata (ricebean): 124835732 Help Entry 124835732         CDS       T09662                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism vum  Vigna umbellata (ricebean) Pathway vum03083   Polycomb repressive complex vum04120   Ubiquitin mediated proteolysis vum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124835732    04120 Ubiquitin mediated proteolysis     124835732   09126 Chromosome    03083 Polycomb repressive complex     124835732  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vum04131]     124835732    04121 Ubiquitin system [BR:vum04121]     124835732    03036 Chromosome and associated proteins [BR:vum03036]     124835732 Membrane trafficking [BR:vum04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     124835732 Ubiquitin system [BR:vum04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      124835732    Cul7 complex      124835732 Chromosome and associated proteins [BR:vum03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      124835732   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      124835732 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Methyltransf_16 Motif Other DBs NCBI-GeneID:  124835732 NCBI-ProteinID:  XP_047166671 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSSARKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVDAANPDDKPSEEDLKAWDADIVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcatcggcgaggaagatcaccctgaagagttccgacggggaggcgttcgaggtggac gaggcggtggcgctggagtcgcagacgataaagcacatgattgaggacgactgcgccgac agcggcatccctctccccaacgttaccagcaagatcctcgctaaagtcatcgagtactgc aaaaaacatgtcgatgccgccaatcccgatgacaaaccttctgaggaagatctcaaggcc tgggacgcggatatcgtcaaggtcgaccaggccacgctcttcgatctcatcctggctgcg aactacctgaacatcaagagcctgctggatcttacatgccagactgtagcagacatgatc aaggggaagactccagaggaaattcgcaagacctttaacattaagaatgacttcacccct gaggaagaagaggaagttcgtcgggaaaatcaatgggcatttgaatga

DBGET integrated database retrieval system