Vigna unguiculata (cowpea): 114178940 Help Entry 114178940         CDS       T06017                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism vun  Vigna unguiculata (cowpea) Pathway vun03030   DNA replication vun03410   Base excision repair vun03420   Nucleotide excision repair vun03430   Mismatch repair vun03440   Homologous recombination Brite KEGG Orthology (KO) [BR:vun00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     114178940    03410 Base excision repair     114178940    03420 Nucleotide excision repair     114178940    03430 Mismatch repair     114178940    03440 Homologous recombination     114178940  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vun03032]     114178940    03400 DNA repair and recombination proteins [BR:vun03400]     114178940 DNA replication proteins [BR:vun03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     114178940 DNA repair and recombination proteins [BR:vun03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       114178940    MMR (mismatch excision repair)     DNA polymerase delta complex      114178940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  114178940 NCBI-ProteinID:  XP_027920897 LinkDB All DBs Position 3:13723268..13723968 Genome browser AA seq 118 aa AA seqDB search MASVTGNMKGFYRQRKTTATKKSSKKSPIHTAIPGSTGVQTPATTANGGKPDLQSECNES EVVLRQFDLNMAYGPCVGIARLARWERAQRLGLNPPQEIEGLLKSGKVQMESLWGGRI NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgtcagtgaccggaaacatgaagggtttttaccgacagaggaaaaccaccgctacg aagaaatcttccaaaaaatctccgatccacaccgccattccgggctctactggggtccaa acgccggccaccaccgctaacggtggaaaaccggacctccaatctgagtgcaatgagagc gaggtggtgttgcggcaattcgatttgaacatggcttatgggccctgcgtcgggatagcg cgacttgcacggtgggagcgtgctcagaggctcggtttgaaccctccgcaggaaatcgag ggtctcttgaagagtgggaaagttcagatggagtccttgtggggtggtcgcatttag

DBGET integrated database retrieval system