Vigna unguiculata (cowpea): 114188150 Help Entry 114188150         CDS       T06017                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism vun  Vigna unguiculata (cowpea) Pathway vun04016   MAPK signaling pathway - plant vun04070   Phosphatidylinositol signaling system vun04075   Plant hormone signal transduction vun04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:vun00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     114188150    04070 Phosphatidylinositol signaling system     114188150    04075 Plant hormone signal transduction     114188150  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     114188150  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vun01009]     114188150   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vun04131]     114188150    03036 Chromosome and associated proteins [BR:vun03036]     114188150   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vun04147]     114188150 Protein phosphatases and associated proteins [BR:vun01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114188150 Membrane trafficking [BR:vun04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114188150 Chromosome and associated proteins [BR:vun03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114188150 Exosome [BR:vun04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114188150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  114188150 NCBI-ProteinID:  XP_027932497 LinkDB All DBs Position 6:11647909..11650106 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc gacaaggatggcgatggttgcattaccaccaaggaacttgggactgtaatgcggtcactt gggcaaaacccaactgaggcagagctgcaggacatgataaatgaggttgatgctgatggc aacggaaccatcgatttcccagaattcctgaacctgatggctcgcaagatgaaagacact gattcagaggaggagcttaaggaagcattccgtgtgttcgacaaggatcagaatggtttt atctctgctgctgagctccgccatgttatgacaaatctgggggagaagctgaccgacgag gaggttgatgagatgattcgcgaggctgatgttgatggcgatgggcagatcaactatgag gagtttgtcaaagtgatgatggccaagtga

DBGET integrated database retrieval system