Vigna unguiculata (cowpea): 114189590 Help Entry 114189590         CDS       T06017                                  Name (RefSeq) calmodulin-like protein 11   KO K02183   calmodulin Organism vun  Vigna unguiculata (cowpea) Pathway vun04016   MAPK signaling pathway - plant vun04070   Phosphatidylinositol signaling system vun04075   Plant hormone signal transduction vun04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:vun00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     114189590    04070 Phosphatidylinositol signaling system     114189590    04075 Plant hormone signal transduction     114189590  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     114189590  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vun01009]     114189590   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vun04131]     114189590    03036 Chromosome and associated proteins [BR:vun03036]     114189590   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vun04147]     114189590 Protein phosphatases and associated proteins [BR:vun01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114189590 Membrane trafficking [BR:vun04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114189590 Chromosome and associated proteins [BR:vun03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114189590 Exosome [BR:vun04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114189590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 DUF5580_M EF-hand_11 RNA_pol_Rpb4 EF_EFCAB10_C SurA_N_3 Caleosin PTS_2-RNA DUF4378 NADPH_Ox RNase_PH_C SurA_N_2 DUF5580 DUF5663 UPF0154 DUF3911 Motif Other DBs NCBI-GeneID:  114189590 NCBI-ProteinID:  XP_027933996 LinkDB All DBs Position 7:19451491..19452509 Genome browser AA seq 148 aa AA seqDB search MANAWTEDQIAIFHEAFDVVDKDSDGFITVEELISIVQSLEGNTTKEEIQEMISKVDMDG KGSVNFEEFLNVIGMRMKENLTEELKDAFKVFDRDNDGYISATELRHVMMKLGERLTEEE VEQMIREADLDGDGRVSYEEFVRFMSLN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcaaatgcatggacagaagatcaaattgctatattccatgaagcctttgatgttgtt gacaaggattctgatggtttcattactgtggaagaactgatatccattgttcagtcatta gaaggaaacacaacaaaagaagaaattcaagaaatgattagtaaagtcgatatggatgga aaaggaagtgtaaattttgaagagttcttgaacgttataggaatgagaatgaaggaaaat ctgaccgaggagctaaaagacgcgttcaaagtgtttgacagagataatgatgggtacata tcagctactgagttgcgacatgtgatgatgaaattgggagagaggctaacagaagaagaa gttgaacaaatgattagagaagcagatttggatggagatggtcgagttagctatgaagaa tttgtgagatttatgtcactaaattga

DBGET integrated database retrieval system