Vespa velutina (Asian hornet): 124949161 Help Entry 124949161         CDS       T09814                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism vve  Vespa velutina (Asian hornet) Pathway vve04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:vve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124949161  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vve04121]     124949161    03400 DNA repair and recombination proteins [BR:vve03400]     124949161 Ubiquitin system [BR:vve04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      124949161    Cul5 complex      124949161 DNA repair and recombination proteins [BR:vve03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124949161 BRITE hierarchy Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Motif Other DBs NCBI-GeneID:  124949161 NCBI-ProteinID:  XP_047349780 EnsemblRapid:  ENSVVEG00005002785 LinkDB All DBs Position 1:complement(2371738..2373716) Genome browser AA seq 116 aa AA seqDB search MDVFLMIRRKNTTIFTDANDNTTVHELKKIIEGILKVPPANQQLFNKDNVVMSDSKYLSD YGLTSITAKAQCPALIGLAIRQENGHFEPLEMTPFSLPPDLPDVMKGCEPNGSESP NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacgtatttttgatgatcaggcgaaaaaataccacgatttttacggatgcaaacgat aatacaacagttcacgaacttaaaaaaattattgaaggtattttgaaagtaccaccagca aatcaacaactatttaacaaagataatgttgttatgtctgattctaaatacctgtcagat tatggattgacatctataactgcaaaagcacaatgtcctgcattgataggattagctata cgtcaagaaaatggccatttcgaaccacttgaaatgactccattttcactaccgcctgat cttccggacgttatgaagggttgtgaacctaatggttcagaatctccttga

DBGET integrated database retrieval system