Vespa velutina (Asian hornet): 124949878 Help Entry 124949878         CDS       T09814                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism vve  Vespa velutina (Asian hornet) Pathway vve04144   Endocytosis vve04517   IgSF CAM signaling vve04518   Integrin signaling vve05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vve00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     124949878    04518 Integrin signaling     124949878  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124949878  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124949878  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vve04131]     124949878    03036 Chromosome and associated proteins [BR:vve03036]     124949878   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vve04147]     124949878    04031 GTP-binding proteins [BR:vve04031]     124949878 Membrane trafficking [BR:vve04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124949878  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     124949878   Macropinocytosis    Ras GTPases     124949878 Chromosome and associated proteins [BR:vve03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     124949878 Exosome [BR:vve04147]  Exosomal proteins   Exosomal proteins of microglial cells    124949878   Exosomal proteins of breast milk    124949878 GTP-binding proteins [BR:vve04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124949878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  124949878 NCBI-ProteinID:  XP_047351620 LinkDB All DBs Position 6:2510184..2512687 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR DDAATIEKLAKNKQKPITGEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVRRRRCVVL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaataaaatgcgttgtggtaggagatggggctgttggtaaaacttgcttattg atttcctacaccacgaataaatttccatcggaatatgtgcctacggtgttcgataattat gccgttacagtaatgattggtggagagccatatacattaggattatttgatactgctggt caggaggattatgatcggctacgaccacttagttatccacaaacggatgtattcctagta tgtttttctgttgtatccccgtcatcttttgaaaacgttaaggaaaagtgggtaccagaa ataactcatcattgtcagaaaacaccttttttacttgttggtacacaaatcgatttaaga gatgatgcagcaactattgaaaaattagcaaaaaataagcaaaaacctatcacaggagag caaggagaaaaacttgcaaaagaactgaaagcagtgaaatatgtagaatgtagtgctctt acgcagaaaggtctaaaaaatgtttttgacgaagcgatcttagcagctttagagccaccg gaaccagttaggagaagacgatgcgttgtcttgtag

DBGET integrated database retrieval system