Vespa velutina (Asian hornet): 124952802 Help Entry 124952802         CDS       T09814                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism vve  Vespa velutina (Asian hornet) Pathway vve04137   Mitophagy - animal vve04140   Autophagy - animal vve04144   Endocytosis vve04145   Phagosome vve04148   Efferocytosis Brite KEGG Orthology (KO) [BR:vve00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124952802    04145 Phagosome     124952802    04140 Autophagy - animal     124952802    04137 Mitophagy - animal     124952802    04148 Efferocytosis     124952802  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vve04131]     124952802   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vve04147]     124952802    04031 GTP-binding proteins [BR:vve04031]     124952802 Membrane trafficking [BR:vve04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     124952802 Exosome [BR:vve04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124952802   Exosomal proteins of other body fluids (saliva and urine)    124952802   Exosomal proteins of colorectal cancer cells    124952802   Exosomal proteins of bladder cancer cells    124952802 GTP-binding proteins [BR:vve04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     124952802 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 PduV-EutP AAA_22 Septin AAA_16 AAA_7 G-alpha AAA_24 AAA_5 NTPase_1 SRPRB AAA_14 ATPase_2 NB-ARC NACHT ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  124952802 NCBI-ProteinID:  XP_047359173 LinkDB All DBs Position 11:complement(1506558..1509303) Genome browser AA seq 207 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRVVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVSAPTSFKSLESWRDEFLIQASPRDPDNFPF VVLGNKVDLESKSVSSKRAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRNNGKGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgtcatcccgcaagaaagtacttttaaaagtaattattctgggagattctggagtaggt aaaacatcattgatgaatcaatatgttaacaaaaagtttagtaatcagtacaaagctact ataggagcagattttctcaccaaagaagttatggtagatgatagggtagttactatgcag atttgggatacggcaggtcaagaaagatttcaatcgttgggagttgcattctatagaggc gcagattgttgtgtattggtatttgatgtttctgcaccaacaagtttcaaatctttagaa tcatggagagacgagtttttgatccaagcatctccacgagatccagataattttccattt gttgttttggggaataaggttgatctagaatctaaatcggtatctagtaagagagcacaa caatggtgtcaatccaaaaacaatattccatattttgagaccagtgcaaaagaggctatt aatgtggaacaggcattccaaacgatagctaagaatgctctagctcaagaaagtgaggtg gaactttataatgagttcccagaccaaattaagctgaccaatgaccaaagaaataatggt aaaggggattcttgtgcatgctag

DBGET integrated database retrieval system