Vespa velutina (Asian hornet): 124954729 Help Entry 124954729         CDS       T09814                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism vve  Vespa velutina (Asian hornet) Pathway vve04068   FoxO signaling pathway vve04081   Hormone signaling vve04140   Autophagy - animal vve04150   mTOR signaling pathway vve04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:vve00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     124954729    04150 mTOR signaling pathway     124954729   09133 Signaling molecules and interaction    04081 Hormone signaling     124954729  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124954729  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     124954729  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vve04052]     124954729 Cytokines and neuropeptides [BR:vve04052]  Neuropeptides   Unclassified    124954729 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  124954729 NCBI-ProteinID:  XP_047364024 LinkDB All DBs Position 16:1185842..1191164 Genome browser AA seq 134 aa AA seqDB search MSTYRFNNAFLALVLVVAAFLIQFGNTQYSFQDKRQPQTLHKYCGKNLSNALGLLCDGVY NSMFKKNGQEMEMDDYPFAYDESYPFRSAVTANAMMGRFAGTRFRREPRGVYDECCVKPC SIQELTSYCGRVSQ NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgtctacatatcgattcaacaacgcctttctggctttggtgctcgtcgtagcggctttc ttaatacaattcggaaacactcaatactctttccaagataagcgacagccgcagacgctg cataagtattgcgggaaaaatctatcgaatgcacttggattgctctgcgacggcgtctac aattctatgtttaaaaagaacgggcaggaaatggaaatggacgattatccgtttgcttat gacgaatcatatccatttagatcggcagttacagcgaatgcaatgatgggtcgttttgcc ggtacacgttttcgaagagaacctagaggcgtttacgatgagtgctgcgtgaaaccatgc tcgattcaggaattaactagttattgcggccgtgtttcgcaataa

DBGET integrated database retrieval system