Vitis vinifera (wine grape): 100247145 Help Entry 100247145         CDS       T01084                                  Name (RefSeq) proteasome subunit beta type-1   KO K02732   20S proteasome subunit beta 6 [EC:3.4.25.1] Organism vvi  Vitis vinifera (wine grape) Pathway vvi03050   Proteasome Brite KEGG Orthology (KO) [BR:vvi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     100247145  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:vvi01002]     100247145   09182 Protein families: genetic information processing    03051 Proteasome [BR:vvi03051]     100247145 Enzymes [BR:vvi01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      100247145 Peptidases and inhibitors [BR:vvi01002]  Threonine peptidases   Family T1: proteasome family    100247145 Proteasome [BR:vvi03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     100247145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proteasome RsfS Motif Other DBs NCBI-GeneID:  100247145 NCBI-ProteinID:  XP_010657217 LinkDB All DBs Position 1:26687176..26687574 Genome browser AA seq 132 aa AA seqDB search MTKQQANWSLYNNNGGSCVAIAGADYCVITSGTRMSIGYNILTCDYSKICKLADKCVMAS SGFQADVRALQKHLAARQLIYQHQHNKQMSCPAMAQLLSNTLYYKRFFPYYSFNVLGGLD NEGKGWVLPRCW NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgacgaagcagcaagctaactggtctctttacaacaacaatggaggatcttgtgttgca attgcaggtgccgattactgcgtcatcacatccggtactcggatgtcgatcggctacaat atcctcacttgtgattactctaaaatctgcaaattagcagacaaatgtgtaatggcctca tctggatttcaagctgatgtaagagctttacagaagcacttggcagctagacagttgatc tatcagcatcagcacaacaagcagatgagttgccctgcaatggctcaactgctctccaac accctctactataaacgtttcttcccttattattcttttaacgttttaggtggccttgat aatgaaggaaagggttgggtcttacccagatgttggtga

DBGET integrated database retrieval system