Vicia villosa (hairy vetch): 131601365 Help Entry 131601365         CDS       T09680                                  Name (RefSeq) SKP1-like protein 1 isoform X1   KO K03094   S-phase kinase-associated protein 1 Organism vvo  Vicia villosa (hairy vetch) Pathway vvo03083   Polycomb repressive complex vvo04120   Ubiquitin mediated proteolysis vvo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vvo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131601365    04120 Ubiquitin mediated proteolysis     131601365   09126 Chromosome    03083 Polycomb repressive complex     131601365  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvo04131]     131601365    04121 Ubiquitin system [BR:vvo04121]     131601365    03036 Chromosome and associated proteins [BR:vvo03036]     131601365 Membrane trafficking [BR:vvo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131601365 Ubiquitin system [BR:vvo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131601365    Cul7 complex      131601365 Chromosome and associated proteins [BR:vvo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131601365   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131601365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  131601365 NCBI-ProteinID:  XP_058729142 LinkDB All DBs Position LG5:complement(14393626..14396039) Genome browser AA seq 155 aa AA seqDB search MSGMMLLKSSDGEIFVIDEAVALESQTIKHMIEDDCADETGIPLPNVTSKILAKVIEYCN KHVDAGKSDGRSVDEDEIKNWDAEFVKVDQQTLFDLILAANYLDIKSLLGLTCKTVADMI KGKTPEEIRKTFNIKNDFTKEEEEEIRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgagtggaatgatgctactcaagagtagtgatggtgagatttttgtaatagacgaagca gtggcgttggagtcccaaactatcaagcatatgattgaggatgattgcgctgatgaaacc ggaatccctcttccaaatgtaacaagcaagattttggccaaggtgattgagtactgcaat aagcacgtcgatgctgggaaatctgatggaagatctgttgacgaggacgaaatcaagaac tgggatgctgaatttgtcaaggttgatcaacagacactctttgatctcatcttggctgca aactacttggacatcaagagtctgttgggtcttacatgtaaaactgtggcggacatgata aagggtaagacaccggaggagattcgcaagactttcaacattaagaatgacttcactaag gaggaagaggaggaaattcgtcgcgaaaatcaatgggcttttgaatga

DBGET integrated database retrieval system