Vicia villosa (hairy vetch): 131606006 Help Entry 131606006         CDS       T09680                                  Name (RefSeq) SKP1-like protein 16   KO K03094   S-phase kinase-associated protein 1 Organism vvo  Vicia villosa (hairy vetch) Pathway vvo03083   Polycomb repressive complex vvo04120   Ubiquitin mediated proteolysis vvo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vvo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131606006    04120 Ubiquitin mediated proteolysis     131606006   09126 Chromosome    03083 Polycomb repressive complex     131606006  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvo04131]     131606006    04121 Ubiquitin system [BR:vvo04121]     131606006    03036 Chromosome and associated proteins [BR:vvo03036]     131606006 Membrane trafficking [BR:vvo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131606006 Ubiquitin system [BR:vvo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131606006    Cul7 complex      131606006 Chromosome and associated proteins [BR:vvo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131606006   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131606006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Sigma54_CBD Motif Other DBs NCBI-GeneID:  131606006 NCBI-ProteinID:  XP_058734277 LinkDB All DBs Position LG5:170198730..170202495 Genome browser AA seq 141 aa AA seqDB search MHAILQGLRLRKTPQFHGLRRTWSRESKQIDSRNTVGINSIQETPSSTQEAFLFQLLHYS LIVFFNFDCESQVKIIYKHLCVFEAANYLNIKNLLDLTCQTVADMIKGKTPKEIRRTFNI MNDFTPKEVEEVRRENQWTFE NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgcatgcaattctgcaaggactacgattacgcaaaactcctcaatttcacggcctgcgg agaacatggtcaagagaatcaaagcaaatcgattcaagaaacacggtcggtattaattca attcaagaaactccatcttcgacacaggaagcttttctcttccagttgcttcactactct ttgattgtgttcttcaactttgattgtgaatcgcaagtcaagattatctacaaacacttg tgtgtctttgaggctgctaactatttaaacatcaagaacttgcttgatcttacatgtcag actgtagcagacatgatcaagggaaagacacctaaggagatccgcaggaccttcaacatt atgaatgacttcactccaaaggaagtggaggaagttcgtcgtgaaaaccagtggactttt gaatga

DBGET integrated database retrieval system