Vicia villosa (hairy vetch): 131606317 Help Entry 131606317         CDS       T09680                                  Name (RefSeq) SKP1-like protein 1A isoform X1   KO K03094   S-phase kinase-associated protein 1 Organism vvo  Vicia villosa (hairy vetch) Pathway vvo03083   Polycomb repressive complex vvo04120   Ubiquitin mediated proteolysis vvo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vvo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131606317    04120 Ubiquitin mediated proteolysis     131606317   09126 Chromosome    03083 Polycomb repressive complex     131606317  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvo04131]     131606317    04121 Ubiquitin system [BR:vvo04121]     131606317    03036 Chromosome and associated proteins [BR:vvo03036]     131606317 Membrane trafficking [BR:vvo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131606317 Ubiquitin system [BR:vvo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131606317    Cul7 complex      131606317 Chromosome and associated proteins [BR:vvo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131606317   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131606317 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  131606317 NCBI-ProteinID:  XP_058734548 LinkDB All DBs Position LG5:complement(14371081..14371560) Genome browser AA seq 159 aa AA seqDB search MASTSAKKINLKSSDGEIFVIDEAVALESQTIKHMIEDDCADETGIPLPNVTSKILAKVI EYCNKHVDAGKSDGRSVDEDEIKNWDAEFVKIDQKTLFDLILAANYLDIKSLLDLTCKTV ADMIKGKTPEEIRKTFNIKNDFTKEEEEEIRRENQWAFE NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atggcatcaacatcagcaaagaagatcaatctcaagagtagtgatggtgagatttttgta atagacgaagcagtggcgttggagtcacaaaccatcaagcatatgattgaggatgattgt gctgatgaaaccggaatccctctcccaaatgtaacaagcaagattttggccaaggtgatt gagtactgcaataagcacgttgatgctgggaaatctgatggaagatcggttgacgaggat gaaatcaagaactgggatgctgaatttgtcaagattgatcagaagacactctttgatctc atcttggctgcaaactacttggacatcaagagtctgttggatcttacatgtaaaactgtg gcggacatgataaagggtaagacaccggaggagattcgcaagactttcaacattaagaat gacttcactaaggaggaagaggaggaaattcgtcgcgaaaatcaatgggcttttgaatga

DBGET integrated database retrieval system