Vicia villosa (hairy vetch): 131612496 Help Entry 131612496         CDS       T09680                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism vvo  Vicia villosa (hairy vetch) Pathway vvo03083   Polycomb repressive complex vvo04120   Ubiquitin mediated proteolysis vvo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vvo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131612496    04120 Ubiquitin mediated proteolysis     131612496   09126 Chromosome    03083 Polycomb repressive complex     131612496  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvo04131]     131612496    04121 Ubiquitin system [BR:vvo04121]     131612496    03036 Chromosome and associated proteins [BR:vvo03036]     131612496 Membrane trafficking [BR:vvo04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131612496 Ubiquitin system [BR:vvo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131612496    Cul7 complex      131612496 Chromosome and associated proteins [BR:vvo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131612496   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131612496 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Peptidase_C30 Motif Other DBs NCBI-GeneID:  131612496 NCBI-ProteinID:  XP_058740272 LinkDB All DBs Position LG6:complement(137520604..137521109) Genome browser AA seq 150 aa AA seqDB search MSSTKMITLKSHDGEIFEVEEAVALESQTIKHMIEDGCAENAIPLPNVTGSILAKIIEYC KKHVDAEASSDDLKEWDAEFVKVDSATLFNIILAANYLNIPSLLELTFQAVAELMKGMTP EEVRTMFNIKNDFTPEEEAEVRRENQWAFE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaaccaagatgatcactctcaagagccacgacggagaaatcttcgaagtagaa gaggctgtggctcttgaatcgcagacgatcaagcacatgatcgaagacggctgtgccgag aacgcaatccctcttccgaacgtgacaggcagcattttggcaaaaattattgaatactgt aagaagcatgtggatgcagaagcgagttccgatgatcttaaggaatgggacgcggagttc gtgaaggttgactcggctacgctattcaatatcatattagctgcaaactatttgaatata ccgagtttgctggagcttacattccaggcagtggcggagttgatgaaggggatgacacca gaggaagttcgaacgatgtttaatattaagaatgactttactccagaggaagaggcggaa gttcgtcgggaaaatcaatgggcttttgaatga

DBGET integrated database retrieval system