Vicia villosa (hairy vetch): 131616422 Help Entry 131616422         CDS       T09680                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism vvo  Vicia villosa (hairy vetch) Pathway vvo04136   Autophagy - other Brite KEGG Orthology (KO) [BR:vvo00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     131616422  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvo04131]     131616422    04121 Ubiquitin system [BR:vvo04121]     131616422    03029 Mitochondrial biogenesis [BR:vvo03029]     131616422 Membrane trafficking [BR:vvo04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     131616422 Ubiquitin system [BR:vvo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    131616422 Mitochondrial biogenesis [BR:vvo03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     131616422 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  131616422 NCBI-ProteinID:  XP_058743736 LinkDB All DBs Position LG7:106160933..106165188 Genome browser AA seq 94 aa AA seqDB search MAAESPTSVRKVVVHLRATGDAPILKQSKFKIAGTDKFAKVIEFLRRQLHRETLFVYVNS AFSPNPDELVVDLYNNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgctgaatctcctacttctgttcgtaaagtggttgttcacctcagagccaccggt gatgctcctattctcaaacaatccaaattcaagatcgctggaactgataaatttgccaaa gtgatagagtttcttcgcagacagctccacagggagacattgtttgtatatgtcaacagt gctttttcaccaaaccctgatgaactggttgttgatttgtataataattttggttttgat ggaaaactggttgtcaactacgcatgttctatggcatggggctaa

DBGET integrated database retrieval system