Vicia villosa (hairy vetch): 131618858 Help Entry 131618858         CDS       T09680                                  Name (RefSeq) calmodulin-like protein 8   KO K02183   calmodulin Organism vvo  Vicia villosa (hairy vetch) Pathway vvo04016   MAPK signaling pathway - plant vvo04070   Phosphatidylinositol signaling system vvo04075   Plant hormone signal transduction vvo04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:vvo00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     131618858    04070 Phosphatidylinositol signaling system     131618858    04075 Plant hormone signal transduction     131618858  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     131618858  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vvo01009]     131618858   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvo04131]     131618858    03036 Chromosome and associated proteins [BR:vvo03036]     131618858   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvo04147]     131618858 Protein phosphatases and associated proteins [BR:vvo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      131618858 Membrane trafficking [BR:vvo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     131618858 Chromosome and associated proteins [BR:vvo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      131618858 Exosome [BR:vvo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    131618858 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 EH AIF-1 SPARC_Ca_bdg Dockerin_1 EF-hand_11 EF_EFCAB10_C RNA_pol_Rpb4 DUF5580_M TerB PTS_2-RNA PADR1_N DUF3741 DUF4891 SurA_N_3 DUF5580 SurA_N_2 BrxA MinC_N_1 Motif Other DBs NCBI-GeneID:  131618858 NCBI-ProteinID:  XP_058745999 LinkDB All DBs Position LG1:146787723..146788791 Genome browser AA seq 148 aa AA seqDB search MTNTLTKDQIAEFHEAFCLIDKDSDGFITVDEFITIIKSLEGNLTKEEIQEIISKANIYG NGRVNFEEFLHIIEIKMKEYLSEELKDAFKVFDSNNDGYISASELTHVMMKLGERLTDEE VEQMIREADLDGDGRVSYEEFAKFMVLN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgacaaacacattgacaaaagatcagattgcagaattccatgaagctttctgcctcatt gacaaggattctgacggattcataactgtggatgaattcataacaattatcaaatcatta gagggaaatctaacaaaagaagaaattcaagaaattattagtaaagctaatatttatgga aatggcagggtaaactttgaagagttcttgcatattattgaaattaaaatgaaggaatat ttgagtgaggagctaaaagatgcattcaaagtatttgatagcaataatgatggatacata tcagctagtgagttgacacatgtgatgatgaaattgggagagaggctaacagatgaagag gttgaacaaatgattagagaggcagatttggatggagatggtagagttagctatgaagaa tttgcaaagtttatggtgctgaattaa

DBGET integrated database retrieval system