Vicia villosa (hairy vetch): 131632155 Help Entry 131632155         CDS       T09680                                  Name (RefSeq) calmodulin-2/4   KO K02183   calmodulin Organism vvo  Vicia villosa (hairy vetch) Pathway vvo04016   MAPK signaling pathway - plant vvo04070   Phosphatidylinositol signaling system vvo04075   Plant hormone signal transduction vvo04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:vvo00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     131632155    04070 Phosphatidylinositol signaling system     131632155    04075 Plant hormone signal transduction     131632155  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     131632155  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vvo01009]     131632155   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvo04131]     131632155    03036 Chromosome and associated proteins [BR:vvo03036]     131632155   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvo04147]     131632155 Protein phosphatases and associated proteins [BR:vvo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      131632155 Membrane trafficking [BR:vvo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     131632155 Chromosome and associated proteins [BR:vvo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      131632155 Exosome [BR:vvo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    131632155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EF-hand_11 EF_EFCAB10_C EFhand_Ca_insen SPARC_Ca_bdg DUF5580_M Dockerin_1 SPEF2_C FCaBP_EF-hand SurA_N_3 PA_Ig-like MotA_activ SurA_N_2 DUF6279 Motif Other DBs NCBI-GeneID:  131632155 NCBI-ProteinID:  XP_058758917 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD QNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcgatcattgggacaaaacccaactgaggcagagcttcaagacatgatcaatgaagta gatgctgacgggaatggtaccattgacttccctgagtttctcaacctcatggcaaggaag atgaaggacaccgactctgaggaggagctgaaagaggcatttcgggttttcgacaaggat cagaatggattcatctctgctgccgagcttcgccatgtgatgaccaaccttggtgagaag ctcactgatgaagaagtcgatgagatgattcgagaggctgatgttgatggtgatggccaa ataaactacgaggaattcgttaaggtgatgatggccaagtga

DBGET integrated database retrieval system