Vicia villosa (hairy vetch): 131632779 Help Entry 131632779         CDS       T09680                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism vvo  Vicia villosa (hairy vetch) Brite KEGG Orthology (KO) [BR:vvo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:vvo03041]     131632779   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvo04052]     131632779 Spliceosome [BR:vvo03041]  Complex B   Other components    Complex B specific factors     131632779 Cytokines and neuropeptides [BR:vvo04052]  Neuropeptides   Unclassified    131632779 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Ubiquitin_4 Rad60-SLD Crinkler Motif Other DBs NCBI-GeneID:  131632779 NCBI-ProteinID:  XP_058759491 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLRDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtgttgaacgatcgattggggaagaaggtccgtgtgaagtgcaacgat gatgacactattggtgatttgaagaagctggtggcggctcagactggaactagggccgac aagatccgtattcagaagtggtacactatctacaaagatcatatcactcttagggattac gagatccatgatggcatgggtcttgaactctactacaactaa

DBGET integrated database retrieval system