Vulpes vulpes (red fox): 112907400 Help Entry 112907400         CDS       T05911                                  Name (RefSeq) tubulin beta-2A chain-like   KO K07375   tubulin beta Organism vvp  Vulpes vulpes (red fox) Pathway vvp04145   Phagosome vvp04517   IgSF CAM signaling vvp04540   Gap junction vvp04814   Motor proteins vvp05010   Alzheimer disease vvp05012   Parkinson disease vvp05014   Amyotrophic lateral sclerosis vvp05016   Huntington disease vvp05020   Prion disease vvp05022   Pathways of neurodegeneration - multiple diseases vvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112907400  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112907400   09144 Cellular community - eukaryotes    04540 Gap junction     112907400   09142 Cell motility    04814 Motor proteins     112907400  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112907400   09164 Neurodegenerative disease    05010 Alzheimer disease     112907400    05012 Parkinson disease     112907400    05014 Amyotrophic lateral sclerosis     112907400    05016 Huntington disease     112907400    05020 Prion disease     112907400    05022 Pathways of neurodegeneration - multiple diseases     112907400  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vvp03036]     112907400   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vvp04812]     112907400    04147 Exosome [BR:vvp04147]     112907400 Chromosome and associated proteins [BR:vvp03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      112907400 Cytoskeleton proteins [BR:vvp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     112907400 Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    112907400   Exosomal proteins of colorectal cancer cells    112907400   Exosomal proteins of bladder cancer cells    112907400 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin Tubulin_3 Tubulin_2 Motif Other DBs NCBI-GeneID:  112907400 NCBI-ProteinID:  XP_025838404 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQG FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQL VENTDETXXXXXXXXXXIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTE AESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggactcggtcaggtctgggccatttggccagatcttcaggcccgacaacttcgtgttt ggccagagcggtgccgggaacaactgggccaagggccactacacggagggcgccgagctg gtggactcggtgctggacgtggtgaggaaggagtcggagagctgtgactgcctgcagggc ttccagctgacgcactcgctgggcggcggcacgggctcgggcatgggcacgctgctcatc agcaagatccgcgaggagtaccccgaccgcatcatgaacaccttcagcgtcatgccctcg cccaaggtgtcggacacggtggtggagccctacaacgccaccttgtcggtgcaccagctg gtggagaacaccgatgagacctannnnnnnnnnnnnnnnnnnnnnnnnntcatcggcaac agcacggccatccaggagctgttcaagcgcatctcggagcagttcacggccatgttccgg cgcaaggccttcctgcactggtacacgggcgagggcatggacgagatggagttcaccgag gccgagagcaacatgaacgacctggtgtccgagtaccagcagtaccaggacgccacggcc gacgaacagggggagttcgaggaggaggagggcgaggacgaggcctag

DBGET integrated database retrieval system