Vulpes vulpes (red fox): 112907712 Help Entry 112907712         CDS       T05911                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism vvp  Vulpes vulpes (red fox) Pathway vvp04613   Neutrophil extracellular trap formation vvp05034   Alcoholism vvp05203   Viral carcinogenesis vvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vvp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112907712  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112907712   09163 Immune disease    05322 Systemic lupus erythematosus     112907712   09165 Substance dependence    05034 Alcoholism     112907712  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vvp03036]     112907712 Chromosome and associated proteins [BR:vvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112907712 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  112907712 NCBI-ProteinID:  XP_025838825 UniProt:  A0A3Q7RA34 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctgggagaggaaagggtggtaagggtctgggcaaagggggcgcgaagcgtcatcgt aaggtcctgagagacaacatccagggtatcactaagccggccattcggcgcctcgctcgg cgtgggggagtgaagcggatctcgggtctcatttacgaagagactcggggtgtcctgaag gtgttcctggagaacgtgatccgggatgccgtcacttacacggagcacgccaagcgcaag acggtcacggccatggacgtagtatacgcgcttaagcgccaaggtcgcactctgtacggc tttgggggctga

DBGET integrated database retrieval system