Vulpes vulpes (red fox): 112908509 Help Entry 112908509         CDS       T05911                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism vvp  Vulpes vulpes (red fox) Pathway vvp04015   Rap1 signaling pathway vvp04810   Regulation of actin cytoskeleton vvp05014   Amyotrophic lateral sclerosis vvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112908509 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112908509 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112908509 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112908509 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112908509 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vvp04812]     112908509 (PFN4)    04147 Exosome [BR:vvp04147]     112908509 (PFN4) Membrane trafficking [BR:vvp04131]  Others   Actin-binding proteins    Others     112908509 (PFN4) Cytoskeleton proteins [BR:vvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112908509 (PFN4) Exosome [BR:vvp04147]  Exosomal proteins   Proteins found in most exosomes    112908509 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112908509 NCBI-ProteinID:  XP_025839747 UniProt:  A0A3Q7R373 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPGDVRTLVNGFAKNPLQTR REGLYFKEKDYKCIRADDYSLYAKNEKTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GKFVPALPPPHASFPMVVRSSHCQ NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgagtcatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagcactcatcaaactccaggagcgaagcttgtgtgtggcatcgccaggatttagtgta atgcctggtgatgtccgaacacttgtgaatggattcgccaagaaccctttacaaaccaga agagaaggattgtatttcaaggaaaaggactacaaatgtatccgggcagatgactattct ctttacgctaagaatgaaaaaactggtgtggtggttgtgaagacccatctatatcttctg gtggcaacttacaccgaaggcatgtatcctagtgtttgtgtggaagccacagagaagctg ggtaagtttgttcccgccctcccccctccccatgcctctttccctatggtagtcagatct tctcactgtcagtaa

DBGET integrated database retrieval system