Vulpes vulpes (red fox): 112909718 Help Entry 112909718         CDS       T05911                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism vvp  Vulpes vulpes (red fox) Brite KEGG Orthology (KO) [BR:vvp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:vvp03041]     112909718   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112909718 Spliceosome [BR:vvp03041]  Complex B   Other components    Complex B specific factors     112909718 Cytokines and neuropeptides [BR:vvp04052]  Neuropeptides   Unclassified    112909718 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  112909718 NCBI-ProteinID:  XP_025841528 UniProt:  A0A3Q7SYD1 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDHLGKKVCVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggttgtttgcaacgaccatctagggaagaaggtctgcgttaagtgcaacact gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggcacccgttggaac aagatcgtcctgaagaagtggtacacgattttcaaggaccacgtgtctctgggggactat gaaatccacgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system