Vulpes vulpes (red fox): 112909719 Help Entry 112909719         CDS       T05911                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism vvp  Vulpes vulpes (red fox) Brite KEGG Orthology (KO) [BR:vvp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:vvp03041]     112909719   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112909719 Spliceosome [BR:vvp03041]  Complex B   Other components    Complex B specific factors     112909719 Cytokines and neuropeptides [BR:vvp04052]  Neuropeptides   Neuropeptides (Unclassified)    112909719 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Crinkler Motif Other DBs NCBI-GeneID:  112909719 NCBI-ProteinID:  XP_025841529 UniProt:  A0A3Q7R5U5 LinkDB All DBs Position Unknown AA seq 66 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDC ILCVTS NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctagggaagaaggtccgcgttaagtgcaacact gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggcacccgttggaac aagatcgtcctgaagaagtggtacacgattttcaaggaccacgtgtctctgggggactgt atcctttgcgtgacttcttga

DBGET integrated database retrieval system