Vulpes vulpes (red fox): 112909840 Help Entry 112909840         CDS       T05911                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism vvp  Vulpes vulpes (red fox) Pathway vvp04144   Endocytosis Brite KEGG Orthology (KO) [BR:vvp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112909840 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112909840 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvp04147]     112909840 (ARF4)    04031 GTP-binding proteins [BR:vvp04031]     112909840 (ARF4) Membrane trafficking [BR:vvp04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     112909840 (ARF4) Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112909840 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    112909840 (ARF4)   Exosomal proteins of colorectal cancer cells    112909840 (ARF4) GTP-binding proteins [BR:vvp04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     112909840 (ARF4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K GTP_EFTU Motif Other DBs NCBI-GeneID:  112909840 NCBI-ProteinID:  XP_025841746 UniProt:  A0A3Q7RHQ7 LinkDB All DBs Position Unknown AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAEELQKMLQEDELRDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctcccttttctcccgcctcttcggcaagaagcagatgcgcatt ttgatggttggattggatgctgctggcaagacgaccattctgtataaactgaagttaggg gagatagtcaccaccattcctaccattggttttaatgtggaaacagtagaatataagaac atttgtttcacagtatgggatgttggtggtcaagataaaattaggcctctctggaggcat tacttccaaaatacccagggtcttatttttgtggtagatagtaatgatcgtgaaagaatt caggagggagctgaagagctgcagaaaatgcttcaggaagatgagttgagagatgcagtg ttgctgctttttgcgaacaaacaggatttgccaaatgctatggccatcagtgaaatgaca gataaattaggtcttcagtctcttcgtaacagaacatggtatgttcaagccacttgtgct acacaaggaactggtctgtatgagggacttgactggctgtcaaatgagctttcaaaacgt taa

DBGET integrated database retrieval system