Vulpes vulpes (red fox): 112910307 Help Entry 112910307         CDS       T05911                                  Name (RefSeq) histone H2A type 1-E   KO K11251   histone H2A Organism vvp  Vulpes vulpes (red fox) Pathway vvp03082   ATP-dependent chromatin remodeling vvp04217   Necroptosis vvp04613   Neutrophil extracellular trap formation vvp05034   Alcoholism vvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vvp00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112910307  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112910307  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112910307  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     112910307   09165 Substance dependence    05034 Alcoholism     112910307  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vvp03036]     112910307   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvp04147]     112910307 Chromosome and associated proteins [BR:vvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112910307 Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112910307 SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Histone_ABTB Clp_N Motif Other DBs NCBI-GeneID:  112910307 NCBI-ProteinID:  XP_025842338 UniProt:  A0A3Q7RA96 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtcgcgggaagcagggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccggcctccagttcccggtgggccgcgtccaccgcctgctccgcaagggcaactac gcggagcgggtcggggcgggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaggccaagggcaagtag

DBGET integrated database retrieval system