Vulpes vulpes (red fox): 112910783 Help Entry 112910783         CDS       T05911                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism vvp  Vulpes vulpes (red fox) Pathway vvp04014   Ras signaling pathway vvp04137   Mitophagy - animal vvp04144   Endocytosis vvp04145   Phagosome vvp04148   Efferocytosis vvp04962   Vasopressin-regulated water reabsorption vvp05132   Salmonella infection vvp05146   Amoebiasis vvp05152   Tuberculosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112910783 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112910783 (RAB5C)    04145 Phagosome     112910783 (RAB5C)    04137 Mitophagy - animal     112910783 (RAB5C)    04148 Efferocytosis     112910783 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     112910783 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112910783 (RAB5C)    05152 Tuberculosis     112910783 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     112910783 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112910783 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvp04147]     112910783 (RAB5C)    04031 GTP-binding proteins [BR:vvp04031]     112910783 (RAB5C) Membrane trafficking [BR:vvp04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     112910783 (RAB5C)  Endosome - Lysosome transport     112910783 (RAB5C) Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112910783 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    112910783 (RAB5C)   Exosomal proteins of colorectal cancer cells    112910783 (RAB5C)   Exosomal proteins of bladder cancer cells    112910783 (RAB5C) GTP-binding proteins [BR:vvp04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     112910783 (RAB5C) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  112910783 NCBI-ProteinID:  XP_025842862 UniProt:  A0A3Q7RBE3 LinkDB All DBs Position Unknown AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPSRNRGVDLQENSPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcgcgacccaatggaccagctgctgggaacaagatctgt caattcaagctggtcctgctcggggaatctgcagtgggcaaatctagcctcgtccttcgc ttcgtcaagggacagttccatgagtaccaggagagcacaattggagcggccttcctcaca cagacggtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggccagccccaacatcgtcattgcactcgcggggaacaaggcagacctggccagc aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc atggagacatccgcaaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag aaacttcccaagaatgagccccagaatgcagctggtgccccgagccggaaccgaggggtg gacctccaggagaacagcccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system