Vulpes vulpes (red fox): 112911068 Help Entry 112911068         CDS       T05911                                  Name (RefSeq) tubulin alpha chain   KO K07374   tubulin alpha Organism vvp  Vulpes vulpes (red fox) Pathway vvp04145   Phagosome vvp04210   Apoptosis vvp04517   IgSF CAM signaling vvp04530   Tight junction vvp04540   Gap junction vvp04814   Motor proteins vvp05010   Alzheimer disease vvp05012   Parkinson disease vvp05014   Amyotrophic lateral sclerosis vvp05016   Huntington disease vvp05020   Prion disease vvp05022   Pathways of neurodegeneration - multiple diseases vvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112911068  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112911068   09143 Cell growth and death    04210 Apoptosis     112911068   09144 Cellular community - eukaryotes    04530 Tight junction     112911068    04540 Gap junction     112911068   09142 Cell motility    04814 Motor proteins     112911068  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112911068   09164 Neurodegenerative disease    05010 Alzheimer disease     112911068    05012 Parkinson disease     112911068    05014 Amyotrophic lateral sclerosis     112911068    05016 Huntington disease     112911068    05020 Prion disease     112911068    05022 Pathways of neurodegeneration - multiple diseases     112911068  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vvp03019]     112911068    03036 Chromosome and associated proteins [BR:vvp03036]     112911068   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vvp04812]     112911068    04147 Exosome [BR:vvp04147]     112911068 Messenger RNA biogenesis [BR:vvp03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      112911068 Chromosome and associated proteins [BR:vvp03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      112911068 Cytoskeleton proteins [BR:vvp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     112911068 Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112911068   Exosomal proteins of other body fluids (saliva and urine)    112911068   Exosomal proteins of colorectal cancer cells    112911068 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin_C DUF7281 Motif Other DBs NCBI-GeneID:  112911068 NCBI-ProteinID:  XP_025843207 LinkDB All DBs Position Unknown AA seq 239 aa AA seqDB search MELRGRRGVGREALASGAGNRRKTSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATY APVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAI ATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLD HKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggagttgcggggaagaaggggggtcgggcgcgaagccctggcgtccggcgctgggaac cgccggaagacctccatcactgcttccctcagatttgatggagccctgaatgtggatctg acggagttccagaccaacctggtgccctatccccgcatccacttccctctggccacatat gcccctgtcatctctgctgagaaagcctaccatgaacagctttctgtagcagagatcacc aatgcatgctttgagccagccaaccagatggtgaaatgtgaccctcgccatggtaaatac atggcttgctgcctgttgtaccgtggtgacgtggttcccaaagatgtcaatgctgccatt gccaccatcaagaccaagcgtaccatccagtttgtggactggtgccccactggcttcaaa gtgggcattaactaccagcctcccactgtggtacccggtggagacctggccaaagtacaa cgagctgtgtgcatgctgagcaacaccacagccattgctgaggcctgggctcgcctggac cacaagtttgacctgatgtatgccaagcgtgcctttgttcactggtatgtgggtgagggc atggaggaaggagagttttctgaggcccgtgaggacatggctgctctggagaaggattat gaggaggttggtgtggattctgttgaaggagagggtgaagaagaaggagaggaatactaa

DBGET integrated database retrieval system