Vulpes vulpes (red fox): 112911519 Help Entry 112911519         CDS       T05911                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism vvp  Vulpes vulpes (red fox) Pathway vvp04014   Ras signaling pathway vvp04015   Rap1 signaling pathway vvp04022   cGMP-PKG signaling pathway vvp04024   cAMP signaling pathway vvp04062   Chemokine signaling pathway vvp04071   Sphingolipid signaling pathway vvp04072   Phospholipase D signaling pathway vvp04081   Hormone signaling vvp04144   Endocytosis vvp04150   mTOR signaling pathway vvp04270   Vascular smooth muscle contraction vvp04310   Wnt signaling pathway vvp04350   TGF-beta signaling pathway vvp04360   Axon guidance vvp04510   Focal adhesion vvp04517   IgSF CAM signaling vvp04519   Cadherin signaling vvp04520   Adherens junction vvp04530   Tight junction vvp04611   Platelet activation vvp04621   NOD-like receptor signaling pathway vvp04625   C-type lectin receptor signaling pathway vvp04660   T cell receptor signaling pathway vvp04670   Leukocyte transendothelial migration vvp04722   Neurotrophin signaling pathway vvp04810   Regulation of actin cytoskeleton vvp04921   Oxytocin signaling pathway vvp04928   Parathyroid hormone synthesis, secretion and action vvp04972   Pancreatic secretion vvp05100   Bacterial invasion of epithelial cells vvp05132   Salmonella infection vvp05133   Pertussis vvp05135   Yersinia infection vvp05152   Tuberculosis vvp05163   Human cytomegalovirus infection vvp05200   Pathways in cancer vvp05203   Viral carcinogenesis vvp05205   Proteoglycans in cancer vvp05206   MicroRNAs in cancer vvp05210   Colorectal cancer vvp05417   Lipid and atherosclerosis vvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112911519 (RHOA)    04015 Rap1 signaling pathway     112911519 (RHOA)    04310 Wnt signaling pathway     112911519 (RHOA)    04350 TGF-beta signaling pathway     112911519 (RHOA)    04072 Phospholipase D signaling pathway     112911519 (RHOA)    04071 Sphingolipid signaling pathway     112911519 (RHOA)    04024 cAMP signaling pathway     112911519 (RHOA)    04022 cGMP-PKG signaling pathway     112911519 (RHOA)    04150 mTOR signaling pathway     112911519 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     112911519 (RHOA)    04517 IgSF CAM signaling     112911519 (RHOA)    04519 Cadherin signaling     112911519 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112911519 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     112911519 (RHOA)    04520 Adherens junction     112911519 (RHOA)    04530 Tight junction     112911519 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112911519 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     112911519 (RHOA)    04621 NOD-like receptor signaling pathway     112911519 (RHOA)    04625 C-type lectin receptor signaling pathway     112911519 (RHOA)    04660 T cell receptor signaling pathway     112911519 (RHOA)    04670 Leukocyte transendothelial migration     112911519 (RHOA)    04062 Chemokine signaling pathway     112911519 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     112911519 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     112911519 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     112911519 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     112911519 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     112911519 (RHOA)   09158 Development and regeneration    04360 Axon guidance     112911519 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112911519 (RHOA)    05206 MicroRNAs in cancer     112911519 (RHOA)    05205 Proteoglycans in cancer     112911519 (RHOA)    05203 Viral carcinogenesis     112911519 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     112911519 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     112911519 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     112911519 (RHOA)    05135 Yersinia infection     112911519 (RHOA)    05133 Pertussis     112911519 (RHOA)    05152 Tuberculosis     112911519 (RHOA)    05100 Bacterial invasion of epithelial cells     112911519 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112911519 (RHOA)    05418 Fluid shear stress and atherosclerosis     112911519 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112911519 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvp04147]     112911519 (RHOA)    04031 GTP-binding proteins [BR:vvp04031]     112911519 (RHOA) Membrane trafficking [BR:vvp04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112911519 (RHOA) Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112911519 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    112911519 (RHOA)   Exosomal proteins of colorectal cancer cells    112911519 (RHOA)   Exosomal proteins of bladder cancer cells    112911519 (RHOA) GTP-binding proteins [BR:vvp04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112911519 (RHOA) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  112911519 NCBI-ProteinID:  XP_025843898 UniProt:  A0A3Q7RF03 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggtaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgtttgaggcctctctcctatccagacactgatgttata ctgatgtgtttctctattgacagccctgatagcttagaaaacatcccagaaaaatggacc ccagaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa ccggaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system