Vulpes vulpes (red fox): 112911646 Help Entry 112911646         CDS       T05911                                  Name (RefSeq) interferon alpha-1/2   KO K05414   interferon alpha Organism vvp  Vulpes vulpes (red fox) Pathway vvp04060   Cytokine-cytokine receptor interaction vvp04151   PI3K-Akt signaling pathway vvp04217   Necroptosis vvp04620   Toll-like receptor signaling pathway vvp04621   NOD-like receptor signaling pathway vvp04622   RIG-I-like receptor signaling pathway vvp04623   Cytosolic DNA-sensing pathway vvp04630   JAK-STAT signaling pathway vvp04650   Natural killer cell mediated cytotoxicity vvp04936   Alcoholic liver disease vvp05152   Tuberculosis vvp05160   Hepatitis C vvp05161   Hepatitis B vvp05162   Measles vvp05163   Human cytomegalovirus infection vvp05164   Influenza A vvp05165   Human papillomavirus infection vvp05167   Kaposi sarcoma-associated herpesvirus infection vvp05168   Herpes simplex virus 1 infection vvp05169   Epstein-Barr virus infection vvp05170   Human immunodeficiency virus 1 infection vvp05171   Coronavirus disease - COVID-19 vvp05200   Pathways in cancer vvp05320   Autoimmune thyroid disease vvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112911646    04151 PI3K-Akt signaling pathway     112911646   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112911646  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112911646  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112911646    04621 NOD-like receptor signaling pathway     112911646    04622 RIG-I-like receptor signaling pathway     112911646    04623 Cytosolic DNA-sensing pathway     112911646    04650 Natural killer cell mediated cytotoxicity     112911646  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112911646   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112911646    05161 Hepatitis B     112911646    05160 Hepatitis C     112911646    05171 Coronavirus disease - COVID-19     112911646    05164 Influenza A     112911646    05162 Measles     112911646    05168 Herpes simplex virus 1 infection     112911646    05163 Human cytomegalovirus infection     112911646    05167 Kaposi sarcoma-associated herpesvirus infection     112911646    05169 Epstein-Barr virus infection     112911646    05165 Human papillomavirus infection     112911646   09171 Infectious disease: bacterial    05152 Tuberculosis     112911646   09163 Immune disease    05320 Autoimmune thyroid disease     112911646   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112911646   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112911646  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112911646 Cytokines and neuropeptides [BR:vvp04052]  Cytokines   Interferons    112911646 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112911646 NCBI-ProteinID:  XP_025844084 UniProt:  A0ABM4YCT9 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALPCSFSLALVLLSCHSLCCLACDLPDAHGLRNWRVLTLLGQMRRLSAGSCDHDTNDFA FPKELFDGQRLQEAQALSVVHVMTQKVFHLFCPDTSSAPWNMTLLEELCSGLSEQLDDLE ACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDKNHSPCAWEMVRAEIGRSFFSSTILQ ERIRRRK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctccttctcgctggccctggtgctgctcagctgccactccctgtgc tgtctggcttgcgacctgcccgacgcccacggcctgcgcaactggagggtcctgacgctc ctgggacagatgaggagactctccgccggctcctgtgaccacgacaccaatgactttgcc ttccccaaggagctgtttgatggccagcggctccaggaggcgcaggccctctctgtggtc cacgtgatgacccagaaggtcttccacctcttctgcccggacacgtcctccgctccttgg aacatgactctcctggaggaactgtgctcggggctctcggagcagctggatgacctggag gcctgtcccctgcaggaggcggggctggccgagacccccctcatgcatgaggactccacc ctgaggacctacttccaaaggatctccctctacctgcaagacaagaaccacagcccgtgt gcctgggagatggtccgagcagaaatcgggagatccttcttctcctcgacaatcttgcaa gaaagaatcaggaggaggaaatga

DBGET integrated database retrieval system