Vulpes vulpes (red fox): 112913601 Help Entry 112913601         CDS       T05911                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism vvp  Vulpes vulpes (red fox) Pathway vvp03008   Ribosome biogenesis in eukaryotes vvp03083   Polycomb repressive complex vvp04064   NF-kappa B signaling pathway vvp04137   Mitophagy - animal vvp04310   Wnt signaling pathway vvp04520   Adherens junction vvp05010   Alzheimer disease vvp05020   Prion disease vvp05022   Pathways of neurodegeneration - multiple diseases vvp05162   Measles vvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:vvp00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     112913601 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     112913601 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112913601 (CSNK2B)    04064 NF-kappa B signaling pathway     112913601 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     112913601 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     112913601 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112913601 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     112913601 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     112913601 (CSNK2B)    05020 Prion disease     112913601 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     112913601 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:vvp03009]     112913601 (CSNK2B)    03036 Chromosome and associated proteins [BR:vvp03036]     112913601 (CSNK2B) Ribosome biogenesis [BR:vvp03009]  Eukaryotic type   90S particles    Kinase     112913601 (CSNK2B) Chromosome and associated proteins [BR:vvp03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      112913601 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  112913601 NCBI-ProteinID:  XP_025846225 UniProt:  A0A3Q7RVY3 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcttggatatcctggttctgtgggctccgtggcaatgaa ttcttttgtgaagtggatgaagactacatccaggataaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccatcacacggatggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcccgcg aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag cttcaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system