Vulpes vulpes (red fox): 112917100 Help Entry 112917100         CDS       T05911                                  Name (RefSeq) cofilin-1   KO K05765   cofilin Organism vvp  Vulpes vulpes (red fox) Pathway vvp04360   Axon guidance vvp04666   Fc gamma R-mediated phagocytosis vvp04810   Regulation of actin cytoskeleton vvp05133   Pertussis vvp05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:vvp00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112917100  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     112917100   09158 Development and regeneration    04360 Axon guidance     112917100  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112917100   09171 Infectious disease: bacterial    05133 Pertussis     112917100  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112917100   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vvp04812]     112917100    04147 Exosome [BR:vvp04147]     112917100 Membrane trafficking [BR:vvp04131]  Others   Actin-binding proteins    Others     112917100 Cytoskeleton proteins [BR:vvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      112917100 Exosome [BR:vvp04147]  Exosomal proteins   Proteins found in most exosomes    112917100 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Mt_ATP-synt_B Motif Other DBs NCBI-GeneID:  112917100 NCBI-ProteinID:  XP_025850764 UniProt:  A0A3Q7RYX4 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKNKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggcgtggcggtttctgatggcgtcatcaaagtgttcaatgacatgaaggtg cgtaagtcttcaacacccgaggaggtgaagaagcgcaagaaggcagttcttttctgcctg agcgaggacaagaagaacatcatcctcgaggagggcaaggagatcctggtaggtgatgtg ggccagactgtagatgacccctacgccacctttgtcaagatgctaccagacaaggactgc cgctatgccctctatgacgcaacctatgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcacctgagtctgcaccccttaagaacaaaatgatttatgccagctcc aaggatgccatcaagaaaaagctgactgggatcaagcatgagttacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaaactggggggcagtgccgtcatctct ctggagggcaagcctttgtga

DBGET integrated database retrieval system