Vulpes vulpes (red fox): 112918104 Help Entry 112918104         CDS       T05911                                  Name (RefSeq) C-C motif chemokine 13   KO K16595   C-C motif chemokine 13 Organism vvp  Vulpes vulpes (red fox) Pathway vvp04060   Cytokine-cytokine receptor interaction vvp04061   Viral protein interaction with cytokine and cytokine receptor vvp04062   Chemokine signaling pathway vvp04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     112918104   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112918104    04061 Viral protein interaction with cytokine and cytokine receptor     112918104  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     112918104  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112918104    00536 Glycosaminoglycan binding proteins [BR:vvp00536]     112918104 Cytokines and neuropeptides [BR:vvp04052]  Cytokines   Chemokines    112918104 Glycosaminoglycan binding proteins [BR:vvp00536]  Heparan sulfate / Heparin   Chemokines    112918104 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  112918104 NCBI-ProteinID:  XP_025852048 UniProt:  A0A3Q7S803 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKVSAALLCLLLTAAILTTPVPAQPDALGALFTCCFTFNNKKIPLQRLESYRITSSHCPR KAVIFSTKLAKAVCADPKEKWVQDYVKHLDQRTQTPKT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcagcgctcctgtgcctgctgctcacagccgccatcctcaccaccccg gtgcccgctcagccagatgcactcggtgccctattcacttgctgcttcacatttaacaat aagaagatccccttgcagagactggagagctatcgaatcaccagcagccactgtccccgg aaagctgtcatcttcagtacgaaactggccaaggctgtctgtgccgacccaaaggagaaa tgggtccaggattatgtgaaacacctggatcaaagaactcaaacgccaaagacttga

DBGET integrated database retrieval system