Vulpes vulpes (red fox): 112920410 Help Entry 112920410         CDS       T05911                                  Name (RefSeq) histone H2A type 1-C-like   KO K11251   histone H2A Organism vvp  Vulpes vulpes (red fox) Pathway vvp03082   ATP-dependent chromatin remodeling vvp04217   Necroptosis vvp04613   Neutrophil extracellular trap formation vvp05034   Alcoholism vvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vvp00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112920410  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112920410  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112920410  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     112920410   09165 Substance dependence    05034 Alcoholism     112920410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vvp03036]     112920410   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvp04147]     112920410 Chromosome and associated proteins [BR:vvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112920410 Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112920410 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  112920410 NCBI-ProteinID:  XP_025854993 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKS ESHHKAKGK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatcccg cgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgcgtg accatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaagagc gagagccaccacaaggccaaagggaagtaa

DBGET integrated database retrieval system