Vulpes vulpes (red fox): 112924248 Help Entry 112924248         CDS       T05911                                  Symbol CFL1 Name (RefSeq) cofilin-1 isoform X1   KO K05765   cofilin Organism vvp  Vulpes vulpes (red fox) Pathway vvp04360   Axon guidance vvp04666   Fc gamma R-mediated phagocytosis vvp04810   Regulation of actin cytoskeleton vvp05133   Pertussis vvp05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:vvp00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112924248 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     112924248 (CFL1)   09158 Development and regeneration    04360 Axon guidance     112924248 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112924248 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     112924248 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112924248 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vvp04812]     112924248 (CFL1)    04147 Exosome [BR:vvp04147]     112924248 (CFL1) Membrane trafficking [BR:vvp04131]  Others   Actin-binding proteins    Others     112924248 (CFL1) Cytoskeleton proteins [BR:vvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      112924248 (CFL1) Exosome [BR:vvp04147]  Exosomal proteins   Proteins found in most exosomes    112924248 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Mt_ATP-synt_B Motif Other DBs NCBI-GeneID:  112924248 NCBI-ProteinID:  XP_025860201 UniProt:  A0A3Q7SWF2 LinkDB All DBs Position Unknown AA seq 164 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDAMRPKSKKEDLVFIFWAPESAPLKSKMIYASSKD AIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atggcctctggcgtggcggtttctgatggcgtcatcaaagtgttcaatgacatgaaggtg cgtaagtcttcaacacccgaggaggtgaagaagcgcaagaaggcagttcttttctgcctg agcgaggacaagaagaacatcatcctcgaggagggcaaggagatcctggtaggtgatgtg ggccagactgtagatgacccctacgccacctttgtcaagatgctaccagacaaggactgc cgctatgccctctatgacgcnatgagaccaaagagcaagaaggaggacctggtgtttatc ttctgggcacctgagtctgcaccccttaagagcaaaatgatttatgccagctccaaggat gccatcaagaaaaagctgactgggatcaagcatgagttacaagcaaactgctacgaggag gtcaaggaccgctgcaccctggcagagaaactggggggcagtgccgtcatctctctggag ggcaagcctttgtga

DBGET integrated database retrieval system