Vulpes vulpes (red fox): 112924926 Help Entry 112924926         CDS       T05911                                  Symbol UBB Name (RefSeq) polyubiquitin-B   KO K04551   ubiquitin B Organism vvp  Vulpes vulpes (red fox) Pathway vvp04120   Ubiquitin mediated proteolysis vvp04137   Mitophagy - animal vvp04140   Autophagy - animal vvp05012   Parkinson disease vvp05022   Pathways of neurodegeneration - multiple diseases vvp05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:vvp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112924926 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112924926 (UBB)    04137 Mitophagy - animal     112924926 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     112924926 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     112924926 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     112924926 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vvp04121]     112924926 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvp04147]     112924926 (UBB) Ubiquitin system [BR:vvp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    112924926 (UBB) Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of breast milk    112924926 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    112924926 (UBB)   Exosomal proteins of colorectal cancer cells    112924926 (UBB)   Exosomal proteins of bladder cancer cells    112924926 (UBB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N HATPase_c UBL_UBAC1 Motif Other DBs NCBI-GeneID:  112924926 NCBI-ProteinID:  XP_025861344 UniProt:  A0A3Q7SIW1 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaaaactctgaccggcaagaccatcaccctggaggtggagcccagt gacaccatcgaaaacgtgaaggccaagatccaggataaagagggcatcccccctgaccag cagaggctcatctttgcaggcaagcagctggaagatggtcgcactctttctgattacaac atccagaaagagtcaaccctgcacctggtcctgcgcctgaggggtggtatgcagatcttc gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccatcgaa aacgtgaaggccaagatccaggataaagagggcatcccccctgaccagcagaggctcatc tttgcaggcaagcagctggaagatggccgcactctttccgattacaacatccagaaagag tcaactctccacctggttctccgtctgaggggtggctgttaa

DBGET integrated database retrieval system