Vulpes vulpes (red fox): 112924987 Help Entry 112924987         CDS       T05911                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism vvp  Vulpes vulpes (red fox) Pathway vvp04015   Rap1 signaling pathway vvp04810   Regulation of actin cytoskeleton vvp05014   Amyotrophic lateral sclerosis vvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112924987  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112924987  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112924987   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112924987  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112924987   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vvp04812]     112924987    04147 Exosome [BR:vvp04147]     112924987 Membrane trafficking [BR:vvp04131]  Others   Actin-binding proteins    Others     112924987 Cytoskeleton proteins [BR:vvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112924987 Exosome [BR:vvp04147]  Exosomal proteins   Proteins found in most exosomes    112924987 SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112924987 NCBI-ProteinID:  XP_025861459 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MPAAVPITTSPVRAARKWGGGAEPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQD GEFTMDLRTKSSGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcctgccgcggtccccatcaccacctcccctgtccgcgctgcccggaagtggggaggg ggagcggaaccagctgaggtcggtgtcctggttggcaaagaccggtcgagttttttcgtg aacgggctgacactgggaggccagaagtgttctgtgatccgggactcgctgctgcaggat ggggagtttactatggaccttcgtaccaagagcagcggtggagcgcccactttcaacatc actgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccacggt ggtatgatcaacaagaaatgttatgaaatggcttcccacctgcggcgttcccagtactga

DBGET integrated database retrieval system